PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla014029
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family MYB
Protein Properties Length: 241aa    MW: 27014.4 Da    PI: 9.9022
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla014029genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.53.5e-092669344
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                     +WT   d+l+ +av + + +   +W +Ia+ ++ g+++ +++ ++
        Cla014029 26 PWTRHQDKLFEHAVVMVPENspnRWVKIAALVP-GKSAADVRYHY 69
                     8********************************.**********9 PP

2Myb_DNA-binding42.21.8e-13121166247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++WT+ E++l++ + k++G+g+W++I+r +  +Rt+ q+ s+ qky
        Cla014029 121 KPWTKKEHQLFLLGLKKFGKGDWRSISRNLVITRTPTQVASHAQKY 166
                      58*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512948.2351977IPR017930Myb domain
SMARTSM007171.2E-82375IPR001005SANT/Myb domain
SuperFamilySSF466895.17E-122581IPR009057Homeodomain-like
PfamPF002496.0E-72669IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-42671IPR009057Homeodomain-like
CDDcd001672.36E-72669No hitNo description
Gene3DG3DSA:1.10.10.606.0E-11112167IPR009057Homeodomain-like
PROSITE profilePS5129418.905115171IPR017930Myb domain
SuperFamilySSF466897.18E-16117172IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-16118170IPR006447Myb domain, plants
SMARTSM007171.2E-11119169IPR001005SANT/Myb domain
PfamPF002496.2E-12121166IPR001005SANT/Myb domain
CDDcd001674.44E-7127167No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MEAASPSFGL LDDYWSPTTS FSSPTPWTRH QDKLFEHAVV MVPENSPNRW VKIAALVPGK  60
SAADVRYHYD VLVSDVLNID SGRVELPSYA DDSASRSPER EESSPPRPLS EKSSSEKKKG  120
KPWTKKEHQL FLLGLKKFGK GDWRSISRNL VITRTPTQVA SHAQKYFLRQ ESAKKDRKRS  180
SIHDITTVDS SLLVTAAAAT SQSQPSIFSV AQLPAPSFPL PQQQQFVSGS YFLYQRSLLD  240
Y
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818754e-82LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132624e-82LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004141984.11e-128PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H73e-57DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0A0KJP91e-128A0A0A0KJP9_CUCSA; Uncharacterized protein
STRINGGLYMA10G42450.12e-75(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.15e-47MYB family protein